PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C001982P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 106aa    MW: 11290.5 Da    PI: 8.6143
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C001982P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.33.2e-324197360
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                     vrY eC+kNhAa++Gg+avDGC+Ef+++ geeg+  al+CaACgCHRnFHRreve+e
  MELO3C001982P1 41 VVRYGECQKNHAANIGGYAVDGCREFLAT-GEEGSNGALTCAACGCHRNFHRREVESE 97
                    79**************************8.999*********************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.0E-294294IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.2E-264394IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.5734493IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2544105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MMMKKRQVVV KRSSEGGGSS SSSSANNNNR NISSSSRVRS VVRYGECQKN HAANIGGYAV  60
DGCREFLATG EEGSNGALTC AACGCHRNFH RREVESEVVC EYSPP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819321e-178LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132661e-178LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442199.15e-71PREDICTED: mini zinc finger protein 1
SwissprotQ9CA512e-39MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A0A0LVI93e-70A0A0A0LVI9_CUCSA; Uncharacterized protein
STRINGGLYMA04G33640.11e-39(Glycine max)
STRINGGLYMA06G20810.11e-39(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.13e-35mini zinc finger 1